Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5B Rabbit Polyclonal Antibody (HRP)

INPP5B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

5PTase

UniProt

P32019

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human INPP5B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005531

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)
abx108052-01 20 µg

Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)

Sign In for Pricing
View Details
Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)
abx108052-02 50 µg

Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)

Sign In for Pricing
View Details
Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)
abx108052-03 100 µg

Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)

Sign In for Pricing
View Details
Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)
abx108052-04 200 µg

Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)

Sign In for Pricing
View Details
Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)
abx108052-05 1 mg

Casein Kinase 2 Beta (CSNK2B) Antibody (HRP)

Sign In for Pricing
View Details
Guinea Pig Cytochrome c oxidase assembly protein COX11, mitochondrial (COX11) ELISA kit
GTR10383166 96 Well

Guinea Pig Cytochrome c oxidase assembly protein COX11, mitochondrial (COX11) ELISA kit

Sign In for Pricing
View Details