Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHA Rabbit Polyclonal Antibody (HRP)

LDHA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LDHM, GSD11, PIG19, HEL-S-133P

UniProt

P00338

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LDHA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005557

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RIPK1 sgRNA gene knockout kit - Lentiviral human RIPK1 sgRNA gene knockout kit (25)
GTR15383814 1 Vial

Lentiviral human RIPK1 sgRNA gene knockout kit - Lentiviral human RIPK1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Sheep Class A basic helix-loop-helix protein 9 (BHLHA9) ELISA Kit
MBS7234391-01 48 Well

Sheep Class A basic helix-loop-helix protein 9 (BHLHA9) ELISA Kit

Sign In for Pricing
View Details
Sheep Class A basic helix-loop-helix protein 9 (BHLHA9) ELISA Kit
MBS7234391-02 96 Well

Sheep Class A basic helix-loop-helix protein 9 (BHLHA9) ELISA Kit

Sign In for Pricing
View Details
Sheep Class A basic helix-loop-helix protein 9 (BHLHA9) ELISA Kit
MBS7234391-03 5x 96 Well

Sheep Class A basic helix-loop-helix protein 9 (BHLHA9) ELISA Kit

Sign In for Pricing
View Details
Sheep Class A basic helix-loop-helix protein 9 (BHLHA9) ELISA Kit
MBS7234391-04 10x 96 Well

Sheep Class A basic helix-loop-helix protein 9 (BHLHA9) ELISA Kit

Sign In for Pricing
View Details
PE Mouse IgM, κ Isotype Control
JOT22337F 25μg

PE Mouse IgM, κ Isotype Control

Sign In for Pricing
View Details