Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAB21L1 Rabbit Polyclonal Antibody (FITC)

MAB21L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

COFG, CAGR1, Nbla00126

UniProt

Q13394

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MAB21L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP5L (NM_182492) Human Recombinant Protein
TP311399L 1 mg

LRP5L (NM_182492) Human Recombinant Protein

Sign In for Pricing
View Details
Total Bile Acid (TBA) Colorimetric Assay Kit
E-BC-K181-M-01 48 T (32 samples)

Total Bile Acid (TBA) Colorimetric Assay Kit

Sign In for Pricing
View Details
Total Bile Acid (TBA) Colorimetric Assay Kit
E-BC-K181-M-02 96 T (80 samples)

Total Bile Acid (TBA) Colorimetric Assay Kit

Sign In for Pricing
View Details
Total Bile Acid (TBA) Colorimetric Assay Kit
E-BC-K181-M-03 500 Assays

Total Bile Acid (TBA) Colorimetric Assay Kit

Sign In for Pricing
View Details
TBCEL Mouse Monoclonal Antibody [Clone ID: AT1B10]
AM50617PU-N 100 µL

TBCEL Mouse Monoclonal Antibody [Clone ID: AT1B10]

Sign In for Pricing
View Details
USP4 (C-term) Rabbit Polyclonal Antibody
AP12009PU-N 400 µL

USP4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details