Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJB1 Rabbit Polyclonal Antibody (HRP)

DNAJB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hdj1, Sis1, HSPF1, Hsp40, RSPH16B

UniProt

P25685

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_006136

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INDO Rabbit mAb
56213 50 µL

INDO Rabbit mAb

Sign In for Pricing
View Details
Human TNFRSF13B/TACI (Tumor necrosis factor receptor superfamily member 13B) QuickTest ELISA Kit
QT-EH0305 96 Tests

Human TNFRSF13B/TACI (Tumor necrosis factor receptor superfamily member 13B) QuickTest ELISA Kit

Sign In for Pricing
View Details
Recombinant Escherichia coli Glycine--tRNA ligase alpha subunit (glyQ)
MBS1001652-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Glycine--tRNA ligase alpha subunit (glyQ)
MBS1001652-02 0.02 mg (Yeast)

Recombinant Escherichia coli Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Glycine--tRNA ligase alpha subunit (glyQ)
MBS1001652-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Glycine--tRNA ligase alpha subunit (glyQ)
MBS1001652-04 0.1 mg (Yeast)

Recombinant Escherichia coli Glycine--tRNA ligase alpha subunit (glyQ)

Sign In for Pricing
View Details