Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cela3b Rabbit Polyclonal Antibody (HRP)

Cela3b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ela3b

UniProt

D3ZFG3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Cela3b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PNGAPCYISGWGRLSTNGPLPDKLQQALLPVVDYAHCSKWDWWGFSVKKT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001100162

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOMM20 Antibody
orb3160022-01 50 µL

TOMM20 Antibody

Sign In for Pricing
View Details
TOMM20 Antibody
orb3160022-02 100 µL

TOMM20 Antibody

Sign In for Pricing
View Details
EIF1B, CT (EIF1B, Eukaryotic translation initiation factor 1b, Protein translation factor SUI1 homolog GC20) (PE)
MBS6294829-01 0.2 mL

EIF1B, CT (EIF1B, Eukaryotic translation initiation factor 1b, Protein translation factor SUI1 homolog GC20) (PE)

Sign In for Pricing
View Details
EIF1B, CT (EIF1B, Eukaryotic translation initiation factor 1b, Protein translation factor SUI1 homolog GC20) (PE)
MBS6294829-02 5x 0.2 mL

EIF1B, CT (EIF1B, Eukaryotic translation initiation factor 1b, Protein translation factor SUI1 homolog GC20) (PE)

Sign In for Pricing
View Details
Recombinant Human LRRC15/LIB Protein, C-Fc
orb3154751-01 50 µg

Recombinant Human LRRC15/LIB Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human LRRC15/LIB Protein, C-Fc
orb3154751-02 100 µg

Recombinant Human LRRC15/LIB Protein, C-Fc

Sign In for Pricing
View Details