Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGALS9 Rabbit Polyclonal Antibody (Biotin)

LGALS9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HUAT, LGALS9A

UniProt

O00182

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LGALS9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033665

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARCH10 (Probable E3 Ubiquitin-protein Ligase MARCH10, Membrane-associated RING Finger Protein 10, Membrane-associated RING-CH Protein X, MARCH-X, RING Finger Protein 190, RNF190, FLJ35757) (MaxLight 750) discontinued
129426-ML750 100 µL

MARCH10 (Probable E3 Ubiquitin-protein Ligase MARCH10, Membrane-associated RING Finger Protein 10, Membrane-associated RING-CH Protein X, MARCH-X, RING Finger Protein 190, RNF190, FLJ35757) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059068-01 0.1 mL

PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059068-02 0.2 mL

PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059068-03 0.5 mL

PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059068-04 1 mL

PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059068-05 5 mL

PE-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details