Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK5 Rabbit Polyclonal Antibody (HRP)

AK5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AK6

UniProt

Q9Y6K8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human AK5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_777283

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mark3, CT (Mark3, Emk2, Mpk10, MAP/microtubule affinity-regulating kinase 3, ELKL motif kinase 2, MPK-10) (MaxLight 750)
MBS6319076-01 0.1 mL

Mark3, CT (Mark3, Emk2, Mpk10, MAP/microtubule affinity-regulating kinase 3, ELKL motif kinase 2, MPK-10) (MaxLight 750)

Sign In for Pricing
View Details
Mark3, CT (Mark3, Emk2, Mpk10, MAP/microtubule affinity-regulating kinase 3, ELKL motif kinase 2, MPK-10) (MaxLight 750)
MBS6319076-02 5x 0.1 mL

Mark3, CT (Mark3, Emk2, Mpk10, MAP/microtubule affinity-regulating kinase 3, ELKL motif kinase 2, MPK-10) (MaxLight 750)

Sign In for Pricing
View Details
RGS1 Antibody
CSB-PA274857 100 µL

RGS1 Antibody

Sign In for Pricing
View Details
ITPRIPL1 siRNA (Human)
MBS8225260-01 15 nmol

ITPRIPL1 siRNA (Human)

Sign In for Pricing
View Details
ITPRIPL1 siRNA (Human)
MBS8225260-02 30 nmol

ITPRIPL1 siRNA (Human)

Sign In for Pricing
View Details
ITPRIPL1 siRNA (Human)
MBS8225260-03 5x 30 nmol

ITPRIPL1 siRNA (Human)

Sign In for Pricing
View Details