Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ak1 Rabbit Polyclonal Antibody (Biotin)

Ak1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ak 1

UniProt

P39069

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Ak1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077325

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insulin discontinued
343957-01 100 µL

Insulin discontinued

Sign In for Pricing
View Details
Insulin discontinued
343957-02 200 µL

Insulin discontinued

Sign In for Pricing
View Details
Rat Slc45a3 Pre-designed siRNA Set A
SI213187A 1 Each

Rat Slc45a3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Camel Pre-B-Cell Leukemia Transcription Factor 1 (PBX1) ELISA Kit
MBS9358124-01 48 Well

Camel Pre-B-Cell Leukemia Transcription Factor 1 (PBX1) ELISA Kit

Sign In for Pricing
View Details
Camel Pre-B-Cell Leukemia Transcription Factor 1 (PBX1) ELISA Kit
MBS9358124-02 96 Well

Camel Pre-B-Cell Leukemia Transcription Factor 1 (PBX1) ELISA Kit

Sign In for Pricing
View Details
Camel Pre-B-Cell Leukemia Transcription Factor 1 (PBX1) ELISA Kit
MBS9358124-03 5x 96 Well

Camel Pre-B-Cell Leukemia Transcription Factor 1 (PBX1) ELISA Kit

Sign In for Pricing
View Details