Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX5 Rabbit Polyclonal Antibody (Biotin)

PRDX5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PLP, ACR1, B166, PRXV, PMP20, PRDX6, prx-V, SBBI10, AOEB166, HEL-S-55

UniProt

B7ZVW3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRDX5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_857635

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), CF®568 Conjugate - Biotium Choice
P015-568-500 1x 500 µL

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), CF®568 Conjugate - Biotium Choice

Sign In for Pricing
View Details
Rat Beta-Site APP Cleaving Enzyme 1 (BACE1) ELISA Kit
abx256725 96 Well

Rat Beta-Site APP Cleaving Enzyme 1 (BACE1) ELISA Kit

Sign In for Pricing
View Details
Catenin- beta (pY142) Antibody
abx149608 100 µg

Catenin- beta (pY142) Antibody

Sign In for Pricing
View Details
Human EVI2B (NM_006495) AAV Particle
RC203253A1V 250 µL

Human EVI2B (NM_006495) AAV Particle

Sign In for Pricing
View Details
HSPA14 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV678741 1.0 µg DNA

HSPA14 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
OCEL1 Rabbit Polyclonal Antibody
orb2951620-01 50 µg

OCEL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details