Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM50B Rabbit Polyclonal Antibody (FITC)

FAM50B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

X5L, D6S2654E

UniProt

Q9Y247

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM50B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTLNDMKARQEALVRER

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036267

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Non-printed, assembled Screw Cap Tube, Conical, PP, 1.5 mL, Sterile, with EPDM ring Cap, White - 1000 un, DNase/RNase free - ABDOS
P40234W 1000 Units/Pack

Non-printed, assembled Screw Cap Tube, Conical, PP, 1.5 mL, Sterile, with EPDM ring Cap, White - 1000 un, DNase/RNase free - ABDOS

Sign In for Pricing
View Details
Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)
MBS1097686-01 0.02 mg (E-Coli)

Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)

Sign In for Pricing
View Details
Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)
MBS1097686-02 0.1 mg (E-Coli)

Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)

Sign In for Pricing
View Details
Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)
MBS1097686-03 0.02 mg (Yeast)

Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)

Sign In for Pricing
View Details
Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)
MBS1097686-04 0.1 mg (Yeast)

Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)

Sign In for Pricing
View Details
Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)
MBS1097686-05 0.02 mg (Baculovirus)

Recombinant Vibrio harveyi Thiosulfate sulfurtransferase glpE (glpE)

Sign In for Pricing
View Details