Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO10 Rabbit Polyclonal Antibody (FITC)

FBXO10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FBX10, PRMT11

UniProt

Q9UK96

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FBXO10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSPSGEDEDEDQLMYR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_036298

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00371 AAV Vector (Human) (CMV)
26717101 1 µg

LINC00371 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
pCMV6-XL4 Plasmid
PVTY00964 2 µg

pCMV6-XL4 Plasmid

Sign In for Pricing
View Details
TNFRSF8 (Y479) (TNFRSF8, CD30, D1S166E, Tumor necrosis factor receptor superfamily member 8, CD30L receptor, Ki-1 antigen, Lymphocyte activation antigen CD30, CD30) (APC)
MBS6357011-01 0.2 mL

TNFRSF8 (Y479) (TNFRSF8, CD30, D1S166E, Tumor necrosis factor receptor superfamily member 8, CD30L receptor, Ki-1 antigen, Lymphocyte activation antigen CD30, CD30) (APC)

Sign In for Pricing
View Details
TNFRSF8 (Y479) (TNFRSF8, CD30, D1S166E, Tumor necrosis factor receptor superfamily member 8, CD30L receptor, Ki-1 antigen, Lymphocyte activation antigen CD30, CD30) (APC)
MBS6357011-02 5x 0.2 mL

TNFRSF8 (Y479) (TNFRSF8, CD30, D1S166E, Tumor necrosis factor receptor superfamily member 8, CD30L receptor, Ki-1 antigen, Lymphocyte activation antigen CD30, CD30) (APC)

Sign In for Pricing
View Details
KMT5C (NM_032701) Human Tagged Lenti ORF Clone
RC203881L4 10 µg

KMT5C (NM_032701) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI1G1]
TA502299 100 µL

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

Sign In for Pricing
View Details