Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO10 Rabbit Polyclonal Antibody (HRP)

FBXO10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FBX10, PRMT11

UniProt

Q9UK96

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBX10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNR

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
orb780624-01 48 Tests

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

Sign In for Pricing
View Details
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
orb780624-02 96 Tests

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

Sign In for Pricing
View Details
PIRC38 Protein Vector (Human) (pPB-N-His)
PV111295 500 ng

PIRC38 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Cdh17 3'UTR Luciferase Stable Cell Line
TU202067 1.0 mL

Cdh17 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
18 L Table top Sterilizer
LX260SS 1 Unit

18 L Table top Sterilizer

Sign In for Pricing
View Details
Ulex Europaeus Lectin 1 Polyclonal Antibody RBITC Conjugated
orb1541354 100 µL

Ulex Europaeus Lectin 1 Polyclonal Antibody RBITC Conjugated

Sign In for Pricing
View Details