Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo22 Rabbit Polyclonal Antibody (FITC)

Fbxo22 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

0610033L19Rik, 1600016C16Rik

UniProt

Q3V492

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HFIKDSKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLHRVV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082325

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD274 (B7-H1, PD-L1) Mouse Monoclonal Antibody (PE)
orb1184087-01 25 Tests

Human CD274 (B7-H1, PD-L1) Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Human CD274 (B7-H1, PD-L1) Mouse Monoclonal Antibody (PE)
orb1184087-02 50 Tests

Human CD274 (B7-H1, PD-L1) Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Human CD274 (B7-H1, PD-L1) Mouse Monoclonal Antibody (PE)
orb1184087-03 100 Tests

Human CD274 (B7-H1, PD-L1) Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Ly6g Antibody
orb1271149 0.5 mg

Ly6g Antibody

Sign In for Pricing
View Details
IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker)
MBS4380036-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker)

Sign In for Pricing
View Details
IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker)
MBS4380036-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker)

Sign In for Pricing
View Details