Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hspbp1 Rabbit Polyclonal Antibody (HRP)

Hspbp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6IMX7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_640354

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAP20 sgRNA CRISPR Lentivector set (Human)
K2512001 3x 1.0 µg

TRNAP20 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Phosphothreonine Antibody (FITC)
orb396904 400 μl

Phosphothreonine Antibody (FITC)

Sign In for Pricing
View Details
5HT1B Receptor Rabbit Polyclonal Antibody (BF405)
orb2546112 100 µL

5HT1B Receptor Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Rabbit anti-TBC1D1 Antibody, Affinity Purified
MBS3905366-01 0.01 mg

Rabbit anti-TBC1D1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TBC1D1 Antibody, Affinity Purified
MBS3905366-02 0.1 mg

Rabbit anti-TBC1D1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TBC1D1 Antibody, Affinity Purified
MBS3905366-03 5x 0.01 mg

Rabbit anti-TBC1D1 Antibody, Affinity Purified

Sign In for Pricing
View Details