Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtpbp4 Rabbit Polyclonal Antibody (HRP)

Gtpbp4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Crfg, RGD1563564

UniProt

F1LMK5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Gtpbp4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CSKTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_446141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFIB / NF1B2 Mouse Monoclonal Antibody [1H4]
EM1701-68 100 µL

NFIB / NF1B2 Mouse Monoclonal Antibody [1H4]

Sign In for Pricing
View Details
CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF405S conjugate, 0.1mg/mL
BNC041654-500 1x 500 µL

CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(2S)-1-(2-Chloroacetyl)-2-9-pyrrolidinecarbonitrile
TRC-C363780-1G 1 g

(2S)-1-(2-Chloroacetyl)-2-9-pyrrolidinecarbonitrile

Sign In for Pricing
View Details
Human TTC7A activation kit by CRISPRa
GA111452 1 Kit

Human TTC7A activation kit by CRISPRa

Sign In for Pricing
View Details
RBMS2 (N-term) Rabbit Polyclonal Antibody
AP53615PU-N 400 µL

RBMS2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific,  10nm
GAF-512-10 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific, 10nm

Sign In for Pricing
View Details