Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHLDA3 Rabbit Polyclonal Antibody (HRP)

PHLDA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIH1

UniProt

Q9Y5J5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PHLDA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e) (PE)
MBS6186151-01 0.1 mL

EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e) (PE)

Sign In for Pricing
View Details
EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e) (PE)
MBS6186151-02 5x 0.1 mL

EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e) (PE)

Sign In for Pricing
View Details
HNRNPM, NT (HNRNPM, HNRPM, NAGR1, Heterogeneous nuclear ribonucleoprotein M) (PE) discontinued
036667-PE 200 µL

HNRNPM, NT (HNRNPM, HNRPM, NAGR1, Heterogeneous nuclear ribonucleoprotein M) (PE) discontinued

Sign In for Pricing
View Details
Rabbit Anti-Mouse Ornithine Decarboxylase (ODC) Polyclonal Antibody
VD3N783 1 Each

Rabbit Anti-Mouse Ornithine Decarboxylase (ODC) Polyclonal Antibody

Sign In for Pricing
View Details
TIP47 (M6PRBP1, Perilipin-3, 47kD Mannose 6-phosphate Receptor-binding Protein, 47kD MPR-binding Protein, Cargo Selection Protein TIP47, Mannose-6-phosphate Receptor-binding Protein 1, Placental Protein 17, PP17, PLIN3) (MaxLight 550)
134464-ML550 100 µL

TIP47 (M6PRBP1, Perilipin-3, 47kD Mannose 6-phosphate Receptor-binding Protein, 47kD MPR-binding Protein, Cargo Selection Protein TIP47, Mannose-6-phosphate Receptor-binding Protein 1, Placental Protein 17, PP17, PLIN3) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Anti Human CANX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)
MBS8422947-01 0.12 mL

Rabbit Anti Human CANX Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)

Sign In for Pricing
View Details