Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNB Rabbit Polyclonal Antibody (HRP)

PITPNB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VIB1B, PtdInsTP, PI-TP-beta

UniProt

P48739

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PITPNB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036531

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF598 antibody - middle region
MBS3203773-01 0.1 mL

ZNF598 antibody - middle region

Sign In for Pricing
View Details
ZNF598 antibody - middle region
MBS3203773-02 5x 0.1 mL

ZNF598 antibody - middle region

Sign In for Pricing
View Details
Erc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
19402116 3x 1.0 µg

Erc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CYP2F1 Peptide - N-terminal region
orb2001761 100 µg

CYP2F1 Peptide - N-terminal region

Sign In for Pricing
View Details
Alpha-1,3-Mannosyl-Glycoprotein 4-Beta-N-Acetylglucosaminyltransferase B (MGAT4B) Antibody (FITC)
abx349535-01 20 µg

Alpha-1,3-Mannosyl-Glycoprotein 4-Beta-N-Acetylglucosaminyltransferase B (MGAT4B) Antibody (FITC)

Sign In for Pricing
View Details
Alpha-1,3-Mannosyl-Glycoprotein 4-Beta-N-Acetylglucosaminyltransferase B (MGAT4B) Antibody (FITC)
abx349535-02 50 µg

Alpha-1,3-Mannosyl-Glycoprotein 4-Beta-N-Acetylglucosaminyltransferase B (MGAT4B) Antibody (FITC)

Sign In for Pricing
View Details