Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNB Rabbit Polyclonal Antibody (FITC)

PITPNB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VIB1B, PtdInsTP, PI-TP-beta

UniProt

P48739

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PITPNB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036531

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sirtuin 6 ELISA Kit
MBS063651-01 48 Well

Rat Sirtuin 6 ELISA Kit

Sign In for Pricing
View Details
Rat Sirtuin 6 ELISA Kit
MBS063651-02 96 Well

Rat Sirtuin 6 ELISA Kit

Sign In for Pricing
View Details
Rat Sirtuin 6 ELISA Kit
MBS063651-03 5x 96 Well

Rat Sirtuin 6 ELISA Kit

Sign In for Pricing
View Details
Rat Sirtuin 6 ELISA Kit
MBS063651-04 10x 96 Well

Rat Sirtuin 6 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human PKP4 sgRNA gene knockout kit - Lentiviral human PKP4 sgRNA gene knockout kit (100)
GTR15362494 1 Vial

Lentiviral human PKP4 sgRNA gene knockout kit - Lentiviral human PKP4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
OVOL1 Rabbit pAb
A14379 50 µL

OVOL1 Rabbit pAb

Sign In for Pricing
View Details