Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFIT5 Rabbit Polyclonal Antibody (Biotin)

IFIT5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P58, RI58, ISG58

UniProt

Q13325

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IFIT5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_036552

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RMI2 Protein Vector (Human) (pPB-C-His)
PV115858 500 ng

RMI2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ODF3, CT (ODF3, SHIPPO1, TISP50, Outer dense fiber protein 3, Outer dense fiber of sperm tails protein 3, Sperm tail protein SHIPPO 1, Transcript induced in spermiogenesis protein 50) (MaxLight 750) discontinued
039263-ML750 100 µL

ODF3, CT (ODF3, SHIPPO1, TISP50, Outer dense fiber protein 3, Outer dense fiber of sperm tails protein 3, Sperm tail protein SHIPPO 1, Transcript induced in spermiogenesis protein 50) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CDKN2AIPNL Protein Vector (Rat) (pPB-N-His)
PV259175 500 ng

CDKN2AIPNL Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
PSME2 Antibody Blocking Peptide
orb1508172 500 µg

PSME2 Antibody Blocking Peptide

Sign In for Pricing
View Details
NPR1 3'UTR Luciferase Stable Cell Line
TU015910 1.0 mL

NPR1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Matrilin-4 ELISA Kit
orb546610 96 Tests

Mouse Matrilin-4 ELISA Kit

Sign In for Pricing
View Details