Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Timm13 Rabbit Polyclonal Antibody (Biotin)

Timm13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Tim, Tim9, Timm, Timm9, D10Ertd378, D10Ertd378e

UniProt

P62075

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038923

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Rabbit IgM Secondary Antibody-Cy3
TMAB-02047C3-01 100 µL

Mouse Anti-Rabbit IgM Secondary Antibody-Cy3

Sign In for Pricing
View Details
Mouse Anti-Rabbit IgM Secondary Antibody-Cy3
TMAB-02047C3-02 1 mL

Mouse Anti-Rabbit IgM Secondary Antibody-Cy3

Sign In for Pricing
View Details
AEBP2 Protein Vector (Mouse) (pPB-C-His)
PV152862 500 ng

AEBP2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ITA6 (ITGA6, Integrin alpha-6, CD49 antigen-like family member F, VLA-6, CD_antigen=CD49f, Integrin alpha-6 heavy chain, Integrin alpha-6 light chain) (MaxLight 750) discontinued
031058-ML750 100 µL

ITA6 (ITGA6, Integrin alpha-6, CD49 antigen-like family member F, VLA-6, CD_antigen=CD49f, Integrin alpha-6 heavy chain, Integrin alpha-6 light chain) (MaxLight 750) discontinued

Sign In for Pricing
View Details
AdmiRa-hsa-miR-433-3p-Off Virus
mh5834 1.0 mL

AdmiRa-hsa-miR-433-3p-Off Virus

Sign In for Pricing
View Details
ZNF408 3'UTR Luciferase Stable Cell Line
TU029155 1.0 mL

ZNF408 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details