Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Timm13 Rabbit Polyclonal Antibody (HRP)

Timm13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tim, Tim9, Timm, Timm9, D10Ertd378, D10Ertd378e

UniProt

P62075

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038923

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM98C Rabbit Polyclonal Antibody (PE)
orb487877 100 µL

FAM98C Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mouse Monoclonal Rad21 Antibody (CM110-2C10) [mFluor Violet 450 SE]
NB100-386MFV450 0.1 mL

Mouse Monoclonal Rad21 Antibody (CM110-2C10) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
LOC285033 Blocking Peptide
33R-9601 100 ug

LOC285033 Blocking Peptide

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Leukemia Inhibitory Factor (LIF)
MBS2164218-01 0.1 mL

PE-Linked Monoclonal Antibody to Leukemia Inhibitory Factor (LIF)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Leukemia Inhibitory Factor (LIF)
MBS2164218-02 0.2 mL

PE-Linked Monoclonal Antibody to Leukemia Inhibitory Factor (LIF)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Leukemia Inhibitory Factor (LIF)
MBS2164218-03 0.5 mL

PE-Linked Monoclonal Antibody to Leukemia Inhibitory Factor (LIF)

Sign In for Pricing
View Details