Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXT1 Rabbit Polyclonal Antibody (FITC)

NXT1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P15, MTR2

UniProt

Q9UKK6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NXT1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM5P 3'UTR GFP Stable Cell Line
TU050292 1.0 mL

ADAM5P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 3 ELISA Kit
MBS084887-01 48 Well

Rat Wingless Type MMTV Integration Site Family, Member 3 ELISA Kit

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 3 ELISA Kit
MBS084887-02 96 Well

Rat Wingless Type MMTV Integration Site Family, Member 3 ELISA Kit

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 3 ELISA Kit
MBS084887-03 5x 96 Well

Rat Wingless Type MMTV Integration Site Family, Member 3 ELISA Kit

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 3 ELISA Kit
MBS084887-04 10x 96 Well

Rat Wingless Type MMTV Integration Site Family, Member 3 ELISA Kit

Sign In for Pricing
View Details
P2RX2 Rabbit Polyclonal Antibody
orb575404 100 µL

P2RX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details