Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXT1 Rabbit Polyclonal Antibody (HRP)

NXT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P15, MTR2

UniProt

Q9UKK6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NXT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK1 Peptide
DF7122-BP 1 mg

GRK1 Peptide

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2 (nuoA2)
MBS7023867-01 0.02 mg

Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2 (nuoA2)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2 (nuoA2)
MBS7023867-02 0.1 mg

Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2 (nuoA2)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2 (nuoA2)
MBS7023867-03 5x 0.1 mg

Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2 (nuoA2)

Sign In for Pricing
View Details
SLAMF7 (NM_021181) Human Tagged Lenti ORF Clone
RC220985L2 10 µg

SLAMF7 (NM_021181) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DOC2A (aa233-246) (Doc2, Doc2-alpha, Double C2-like domain-containing protein alpha, Double C2-like domains, alpha)
208131 100 µg

DOC2A (aa233-246) (Doc2, Doc2-alpha, Double C2-like domain-containing protein alpha, Double C2-like domains, alpha)

Sign In for Pricing
View Details