Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Shpk Rabbit Polyclonal Antibody (FITC)

Shpk Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ca, Carkl, AI194947, AW260459, 4930431K22Rik

UniProt

Q9D5J6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NGGNVLATFVHMLVQWMADLGLEVEESTVYSRMIQAAAQQKDTHLTITPT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_083307

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human K2C74 (His)
BP4037-500ug 500 µg

Recombinant Human K2C74 (His)

Sign In for Pricing
View Details
FGF7/KGF Rabbit pAb
E45R17663N 50 ul

FGF7/KGF Rabbit pAb

Sign In for Pricing
View Details
EasySortTM Human Memory CD4+T Cell Isolation Kit
MIH009N-01 10 Assays

EasySortTM Human Memory CD4+T Cell Isolation Kit

Sign In for Pricing
View Details
EasySortTM Human Memory CD4+T Cell Isolation Kit
MIH009N-02 100 Assays

EasySortTM Human Memory CD4+T Cell Isolation Kit

Sign In for Pricing
View Details
EasySortTM Human Memory CD4+T Cell Isolation Kit
MIH009N-03 200 Assays

EasySortTM Human Memory CD4+T Cell Isolation Kit

Sign In for Pricing
View Details
Recombinant Mouse Uncharacterized protein KIAA0564 homolog (Kiaa0564) , partial
MBS1382728 Inquire

Recombinant Mouse Uncharacterized protein KIAA0564 homolog (Kiaa0564) , partial

Sign In for Pricing
View Details