Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Shpk Rabbit Polyclonal Antibody (HRP)

Shpk Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ca, Carkl, AI194947, AW260459, 4930431K22Rik

UniProt

Q9D5J6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGGNVLATFVHMLVQWMADLGLEVEESTVYSRMIQAAAQQKDTHLTITPT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_083307

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 1 (KRT1) Human Gene Knockout Kit (CRISPR)
KN423146 1 Kit

Cytokeratin 1 (KRT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ces1e Mouse Gene Knockout Kit (CRISPR)
KN503191 1 Kit

Ces1e Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fragilis Recombinant Rabbit monoclonal Antibody
HA750453 100 µL

Fragilis Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Pepsin Microplate Assay Kit
RDSM081 100 Assays

Pepsin Microplate Assay Kit

Sign In for Pricing
View Details
PGP9.5 Recombinant Rabbit monoclonal Antibody [JM10-59]
ET1703-22-50UL 50 µL

PGP9.5 Recombinant Rabbit monoclonal Antibody [JM10-59]

Sign In for Pricing
View Details
StrandBrite™ Green RNA Quantifying Reagent *200X DMSO Solution*
17611-AAT 10 mL

StrandBrite™ Green RNA Quantifying Reagent *200X DMSO Solution*

Sign In for Pricing
View Details