Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOOK2 Rabbit Polyclonal Antibody (Biotin)

HOOK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HK2

UniProt

Q96ED9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human HOOK2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LRRAGSLRAQLEAQRRQVQELQGQRQEEAMKAEKWLFECRNLEEKYESVT

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037444

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Pro-neuregulin-1, membrane-bound isoform ELISA Kit
MBS9427861-01 96 Tests

Rat Pro-neuregulin-1, membrane-bound isoform ELISA Kit

Sign In for Pricing
View Details
Rat Pro-neuregulin-1, membrane-bound isoform ELISA Kit
MBS9427861-02 5x 96 Tests

Rat Pro-neuregulin-1, membrane-bound isoform ELISA Kit

Sign In for Pricing
View Details
IP-10 (Cxcl10, C-X-C Motif Chemokine 10, 10kD Interferon gamma-induced Protein, Gamma-IP10, Interferon-inducible Protein 10, Protein Mob-1, Small-inducible Cytokine B10, Inp10, Mob1, Scyb10) (MaxLight 550) discontinued
143636-ML550 100 µL

IP-10 (Cxcl10, C-X-C Motif Chemokine 10, 10kD Interferon gamma-induced Protein, Gamma-IP10, Interferon-inducible Protein 10, Protein Mob-1, Small-inducible Cytokine B10, Inp10, Mob1, Scyb10) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Human YWHAG Protein, N-His
orb2819857-01 20 µg

Recombinant Human YWHAG Protein, N-His

Sign In for Pricing
View Details
Recombinant Human YWHAG Protein, N-His
orb2819857-02 50 µg

Recombinant Human YWHAG Protein, N-His

Sign In for Pricing
View Details
Recombinant Human YWHAG Protein, N-His
orb2819857-03 100 µg

Recombinant Human YWHAG Protein, N-His

Sign In for Pricing
View Details