Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx10 Rabbit Polyclonal Antibody (Biotin)

Snx10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

2410004M09Rik

UniProt

Q9CWT3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001120820

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MALT1 Antibody
V7669-20UG 20 µg

Recombinant MALT1 Antibody

Sign In for Pricing
View Details
ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)
TRV-0042962-01 24 Tests

ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details
ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)
TRV-0042962-02 48 Tests

ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details
ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)
TRV-0042962-03 96 Tests

ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details
ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)
TRV-0042962-04 5x 96 Tests

ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details
ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)
TRV-0042962-05 10x 96 Tests

ELISA Kit for LETM1 Domain Containing Protein 1 (LETMD1)

Sign In for Pricing
View Details