Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYCR2 Rabbit Polyclonal Antibody (HRP)

PYCR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HLD10, P5CR2

UniProt

Q96C36

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PYCR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPOR recombinant monoclonal antibody
A5509 100ul X 3

TPOR recombinant monoclonal antibody

Sign In for Pricing
View Details
NOS3 Polyclonal Antibody
ABP0161 100 µL

NOS3 Polyclonal Antibody

Sign In for Pricing
View Details
Human TBK1 ELISA Kit (Ready to Use)
orb552531-01 48 Tests

Human TBK1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human TBK1 ELISA Kit (Ready to Use)
orb552531-02 96 Tests

Human TBK1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Galr3 sgRNA CRISPR Lentivector set (Mouse)
K3834001 3x 1.0 µg

Galr3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
5- (Triethylsilyl) -1,3-benzodioxole
OR1084610-01 250 mg

5- (Triethylsilyl) -1,3-benzodioxole

Sign In for Pricing
View Details