Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPN1 Rabbit Polyclonal Antibody (Biotin)

EPN1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9Y6I3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPN1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA3 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-60794R-PerCP-Cy5.5 100 µL

GATA3 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
POU6F2 Antibody Blocking Peptide
orb1503076 500 µg

POU6F2 Antibody Blocking Peptide

Sign In for Pricing
View Details
UBA5, Recombinant, Human, aa1-404, His-Tag (Ubiquitin-like modifier-activating Enzyme 5, THIFP1, UBE1DC1)
351556-01 50 µg

UBA5, Recombinant, Human, aa1-404, His-Tag (Ubiquitin-like modifier-activating Enzyme 5, THIFP1, UBE1DC1)

Sign In for Pricing
View Details
UBA5, Recombinant, Human, aa1-404, His-Tag (Ubiquitin-like modifier-activating Enzyme 5, THIFP1, UBE1DC1)
351556-02 250 µg

UBA5, Recombinant, Human, aa1-404, His-Tag (Ubiquitin-like modifier-activating Enzyme 5, THIFP1, UBE1DC1)

Sign In for Pricing
View Details
BORG2 Antibody
MBS9605365-01 0.1 mL

BORG2 Antibody

Sign In for Pricing
View Details
BORG2 Antibody
MBS9605365-02 0.2 mL

BORG2 Antibody

Sign In for Pricing
View Details