Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPN1 Rabbit Polyclonal Antibody (FITC)

EPN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9Y6I3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-delta 1 Catenin (Tyr228) Polyclonal Antibody, PE-Cy7 Conjugated
bs-12992R-PE-Cy7 100 µL

Phospho-delta 1 Catenin (Tyr228) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Phospho-RAF1 (Ser289) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-3372R-APC-Cy5.5 100 µL

Phospho-RAF1 (Ser289) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
BNIP3L (NM_004331) Human Over-expression Lysate
LS000665-20ug 20 µg

BNIP3L (NM_004331) Human Over-expression Lysate

Sign In for Pricing
View Details
LONRF2 Rabbit Polyclonal Antibody (HRP)
orb2120624 100 µL

LONRF2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Nori® Bat CCL2 ELISA Kit
GR218002 96 Well

Nori® Bat CCL2 ELISA Kit

Sign In for Pricing
View Details
COX6A1 CRISPR Knock Out 293T Cell Line (Human)
16695141 1x 10^6 Cells / 1.0 mL

COX6A1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details