Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPN1 Rabbit Polyclonal Antibody (HRP)

EPN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9Y6I3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit C4a (Complement Component 4a) ValidElisa Kit
EK346326 96 Well

Rabbit C4a (Complement Component 4a) ValidElisa Kit

Sign In for Pricing
View Details
3- (N-Isopropyl-N- (4-methoxybenzyl) sulfamoyl) phenylboronic acid
423302-01 25 mg

3- (N-Isopropyl-N- (4-methoxybenzyl) sulfamoyl) phenylboronic acid

Sign In for Pricing
View Details
3- (N-Isopropyl-N- (4-methoxybenzyl) sulfamoyl) phenylboronic acid
423302-02 50 mg

3- (N-Isopropyl-N- (4-methoxybenzyl) sulfamoyl) phenylboronic acid

Sign In for Pricing
View Details
DEFB106B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV709246 1.0 µg DNA

DEFB106B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
TNFAIP3 Adenovirus (Mouse)
47191054 1.0 mL

TNFAIP3 Adenovirus (Mouse)

Sign In for Pricing
View Details
Rat Tcp10b Pre-designed siRNA Set B
SI214321B 1 Each

Rat Tcp10b Pre-designed siRNA Set B

Sign In for Pricing
View Details