Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNMA3 Rabbit Polyclonal Antibody (Biotin)

PNMA3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MA3, MA5

UniProt

Q9UL41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PNMA3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_037496

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gstm3 shRNA Plasmid (m)
sc-145811-SH 20 µg

Gstm3 shRNA Plasmid (m)

Sign In for Pricing
View Details
Anti-Human herpesvirus 4 BDLF1 Antibody, Carrier-free
DZ41535-carrier-free 200 µL/Vial

Anti-Human herpesvirus 4 BDLF1 Antibody, Carrier-free

Sign In for Pricing
View Details
Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Polyclonal Antibody
CAU28344-01 100 µL

Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Polyclonal Antibody

Sign In for Pricing
View Details
Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Polyclonal Antibody
CAU28344-02 200 µL

Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Polyclonal Antibody

Sign In for Pricing
View Details
Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Polyclonal Antibody
CAU28344-03 1 mL

Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Polyclonal Antibody

Sign In for Pricing
View Details
ROBO3 Polyclonal Antibody
MBS2527884-01 0.02 mL

ROBO3 Polyclonal Antibody

Sign In for Pricing
View Details