Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNMA3 Rabbit Polyclonal Antibody (HRP)

PNMA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MA3, MA5

UniProt

Q9UL41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PNMA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_037496

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EP3/PTGER3 Rabbit pAb, AP conjugated
orb2852176 100 µL

EP3/PTGER3 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
SM22 alpha (Transgelin, Smooth Muscle Protein 22-alpha, TAGLN, Protein WS3-10, 22kD Actin-binding Protein, WS3-10, SM22)
029356 100 µg

SM22 alpha (Transgelin, Smooth Muscle Protein 22-alpha, TAGLN, Protein WS3-10, 22kD Actin-binding Protein, WS3-10, SM22)

Sign In for Pricing
View Details
Upstream Binding Protein 1 Antibody
orb1328884 100 µg

Upstream Binding Protein 1 Antibody

Sign In for Pricing
View Details
TMEM114 Recombinant Protein (Rat)
RP233453 100 µg

TMEM114 Recombinant Protein (Rat)

Sign In for Pricing
View Details
TECK Human, His
OM301803-01 20 µg

TECK Human, His

Sign In for Pricing
View Details
TECK Human, His
OM301803-02 5 µg

TECK Human, His

Sign In for Pricing
View Details