Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNMA3 Rabbit Polyclonal Antibody (HRP)

PNMA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MA3, MA5

UniProt

Q9UL41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PNMA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_037496

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) (N/A), CF488A conjugate, 0.1mg/mL
BNC881800-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (N/A), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9), CF647 conjugate, 0.1mg/mL
BNC470143-100 1x 100 µL

S100B (4C4.9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike Protein (RBD, His Tag)
PKSR030499 100 µg

Recombinant SARS-CoV-2 Spike Protein (RBD, His Tag)

Sign In for Pricing
View Details
ATPase Activity Assay Kit
E-BC-K831-M 96 T (40 samples)

ATPase Activity Assay Kit

Sign In for Pricing
View Details
Recombinant Mouse IL-17C Protein (Sumo Tag)
PDEM100174-01 20 µg

Recombinant Mouse IL-17C Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17C Protein (Sumo Tag)
PDEM100174-02 100 µg

Recombinant Mouse IL-17C Protein (Sumo Tag)

Sign In for Pricing
View Details