Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lig3 Rabbit Polyclonal Antibody (Biotin)

Lig3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

D11Wsu78, D11Wsu78e

UniProt

Q80ZH7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TPCLKKVLLDVFTGVRLYLPPSTPDFKRLKRYFVAFDGDLVQEFDMGSAT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

111kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034846

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPY2C sgRNA CRISPR Lentivector (Human) (Target 2)
K0193003 1.0 µg DNA

BPY2C sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Recombinant Protein
TP325656 20 µg

alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Recombinant Protein

Sign In for Pricing
View Details
Epithelial Sodium Channel gamma (SCNN1G) (NM_001039) Human Over-expression Lysate
LS006340-20ug 20 µg

Epithelial Sodium Channel gamma (SCNN1G) (NM_001039) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Putative transcriptional regulator (PA0034)
MBS1023032-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Putative transcriptional regulator (PA0034)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Putative transcriptional regulator (PA0034)
MBS1023032-02 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Putative transcriptional regulator (PA0034)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Putative transcriptional regulator (PA0034)
MBS1023032-03 0.02 mg (Yeast)

Recombinant Pseudomonas aeruginosa Putative transcriptional regulator (PA0034)

Sign In for Pricing
View Details