Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lig3 Rabbit Polyclonal Antibody (HRP)

Lig3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

D11Wsu78, D11Wsu78e

UniProt

Q80ZH7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TPCLKKVLLDVFTGVRLYLPPSTPDFKRLKRYFVAFDGDLVQEFDMGSAT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

111kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034846

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chlamydia muridarum Chaperone protein DnaK (dnaK), partial
MBS1248217 Inquire

Recombinant Chlamydia muridarum Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details
E cadherin Rabbit Polyclonal Antibody (APC)
orb1005282 100 µL

E cadherin Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Mouse MAP3K7 shRNA Plasmid
abx973697-01 150 µg

Mouse MAP3K7 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MAP3K7 shRNA Plasmid
abx973697-02 300 µg

Mouse MAP3K7 shRNA Plasmid

Sign In for Pricing
View Details
Anti-Fibronectin/FN1 Antibody Picoband®
A00564-3 100 µg/Vial

Anti-Fibronectin/FN1 Antibody Picoband®

Sign In for Pricing
View Details
TFF3 Rabbit Polyclonal Antibody (Cy3)
orb987738 100 µL

TFF3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details