Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chmp2b Rabbit Polyclonal Antibody (HRP)

Chmp2b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1306781

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Chmp2b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001063932

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ppp1r32 shRNA (UAS) - Lentiviral mouse Ppp1r32 shRNA (UAS, iRFP) (100)
GTR15254187 1 Vial

Lentiviral mouse Ppp1r32 shRNA (UAS) - Lentiviral mouse Ppp1r32 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
LMO2 Rabbit Monoclonal antibody
AMRe02216-01 1 Each

LMO2 Rabbit Monoclonal antibody

Sign In for Pricing
View Details
LMO2 Rabbit Monoclonal antibody
AMRe02216-02 50 µL

LMO2 Rabbit Monoclonal antibody

Sign In for Pricing
View Details
LMO2 Rabbit Monoclonal antibody
AMRe02216-03 100 µL

LMO2 Rabbit Monoclonal antibody

Sign In for Pricing
View Details
Fasudil Hydrochloride Impurity G
RM-F226807-01 10 mg

Fasudil Hydrochloride Impurity G

Sign In for Pricing
View Details
Fasudil Hydrochloride Impurity G
RM-F226807-02 25 mg

Fasudil Hydrochloride Impurity G

Sign In for Pricing
View Details