Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chmp2b Rabbit Polyclonal Antibody (HRP)

Chmp2b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1306781

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Chmp2b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001063932

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-3689b-3p miRNA Mimic
orb1877579-01 5 nmol

Hsa-miR-3689b-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-3689b-3p miRNA Mimic
orb1877579-02 10 nmol

Hsa-miR-3689b-3p miRNA Mimic

Sign In for Pricing
View Details
RPL23AP8 3'UTR GFP Stable Cell Line
TU071073 1.0 mL

RPL23AP8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GALNT7 Protein Vector (Human) (pPB-N-His)
PV017186 500 ng

GALNT7 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
NT5C3 Protein Vector (Mouse) (pPM-C-HA)
PV206940 500 ng

NT5C3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Erg shRNA (UAS) - Lentiviral mouse Erg shRNA (UAS, iRFP) plasmid
GTR15240532 1 Vial

Lentiviral mouse Erg shRNA (UAS) - Lentiviral mouse Erg shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details