Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL13 Rabbit Polyclonal Antibody (Biotin)

MRPL13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L13, L13A, L13mt, RPL13, RPML13

UniProt

Q9BYD1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPL13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054797

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF160 Rabbit Polyclonal Antibody
orb581412 100 µL

ZNF160 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CABP1 Rabbit Polyclonal Antibody (BF750)
orb2538937 100 µL

CABP1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)
MBS2095263-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)
MBS2095263-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)
MBS2095263-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)
MBS2095263-04 1 mL

Biotin-Linked Polyclonal Antibody to Dickkopf Related Protein 3 (DKK3)

Sign In for Pricing
View Details