Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL5 Rabbit Polyclonal Antibody (Biotin)

METTL5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MRT72, HSPC133

UniProt

Q9NRN9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human METTL5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT6A Peptide - middle region
MBS3241310-01 0.1 mg

KRT6A Peptide - middle region

Sign In for Pricing
View Details
KRT6A Peptide - middle region
MBS3241310-02 5x 0.1 mg

KRT6A Peptide - middle region

Sign In for Pricing
View Details
Human Prostaglandin I Synthase (PTGIS) ELISA Kit
abx573809-01 96 Tests

Human Prostaglandin I Synthase (PTGIS) ELISA Kit

Sign In for Pricing
View Details
Human Prostaglandin I Synthase (PTGIS) ELISA Kit
abx573809-02 5x 96 Tests

Human Prostaglandin I Synthase (PTGIS) ELISA Kit

Sign In for Pricing
View Details
Human Prostaglandin I Synthase (PTGIS) ELISA Kit
abx573809-03 10x 96 Tests

Human Prostaglandin I Synthase (PTGIS) ELISA Kit

Sign In for Pricing
View Details
DEN1A, CT (DENND1A, FAM31A, KIAA1608, DENN domain-containing protein 1A, Connecdenn 1, Protein FAM31A) (MaxLight 650)
MBS6291692-01 0.1 mL

DEN1A, CT (DENND1A, FAM31A, KIAA1608, DENN domain-containing protein 1A, Connecdenn 1, Protein FAM31A) (MaxLight 650)

Sign In for Pricing
View Details