Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL5 Rabbit Polyclonal Antibody (HRP)

METTL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRT72, HSPC133

UniProt

Q9NRN9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human METTL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DMPK Polyclonal Antibody
HB448014-01 50 µg

Anti-DMPK Polyclonal Antibody

Sign In for Pricing
View Details
Anti-DMPK Polyclonal Antibody
HB448014-02 100 µg

Anti-DMPK Polyclonal Antibody

Sign In for Pricing
View Details
Fam57b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4100308 1.0 µg DNA

Fam57b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
EpCAM/TROP1 Protein, Cynomolgus, Recombinant (His)
TMPY-03722-01 5 µg

EpCAM/TROP1 Protein, Cynomolgus, Recombinant (His)

Sign In for Pricing
View Details
EpCAM/TROP1 Protein, Cynomolgus, Recombinant (His)
TMPY-03722-02 10 µg

EpCAM/TROP1 Protein, Cynomolgus, Recombinant (His)

Sign In for Pricing
View Details
EpCAM/TROP1 Protein, Cynomolgus, Recombinant (His)
TMPY-03722-03 20 µg

EpCAM/TROP1 Protein, Cynomolgus, Recombinant (His)

Sign In for Pricing
View Details