Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf62 Rabbit Polyclonal Antibody (FITC)

C19orf62 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NBA1, HSPC142, MERIT40, C19orf62

UniProt

Q9NWV8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf62

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_054892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSE Recombinant Rabbit mAb, PerCP-Cy5.5 conjugated
orb2332070 100 µL

NSE Recombinant Rabbit mAb, PerCP-Cy5.5 conjugated

Sign In for Pricing
View Details
Goat Polyclonal SOD2/Mn-SOD Antibody [DyLight 405]
NB200-165V 0.1 mL

Goat Polyclonal SOD2/Mn-SOD Antibody [DyLight 405]

Sign In for Pricing
View Details
Rabbit Polyclonal DHTKD1 Antibody [DyLight 405]
NBP2-99197V 0.1 mL

Rabbit Polyclonal DHTKD1 Antibody [DyLight 405]

Sign In for Pricing
View Details
Monkey Activated RNA polymerase II transcriptional coactivator p15 (SUB1) ELISA kit
GTR10402813 96 Well

Monkey Activated RNA polymerase II transcriptional coactivator p15 (SUB1) ELISA kit

Sign In for Pricing
View Details
Brush Flask Bristle 50x100x380mm
BRU1060 5 / PCK

Brush Flask Bristle 50x100x380mm

Sign In for Pricing
View Details
ARF, p14 (p16beta) (BSA & Azide Free)
MBS6463909-01 0.1 mL

ARF, p14 (p16beta) (BSA & Azide Free)

Sign In for Pricing
View Details