Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf62 Rabbit Polyclonal Antibody (HRP)

C19orf62 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NBA1, HSPC142, MERIT40, C19orf62

UniProt

Q9NWV8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf62

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_054892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Soft tissue
CS805417 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB516114 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
MAPK14 (CPTC-MAPK14-1), CF594 conjugate, 0.1mg/mL
BNC942228-500 1x 500 µL

MAPK14 (CPTC-MAPK14-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS801251 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
PMM1 Human Gene Knockout Kit (CRISPR)
KN202004RB 1 Kit

PMM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FGF1 Rabbit Polyclonal Antibody
TA376219 100 µL

FGF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details