Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THYN1 Rabbit Polyclonal Antibody (FITC)

THYN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MY105, THY28, MDS012, HSPC144, THY28KD

UniProt

Q9P016

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human THYN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_054893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Nucleoporin 133kDa ELISA kit
GTR10450753 96 Well

Canine Nucleoporin 133kDa ELISA kit

Sign In for Pricing
View Details
SCD Rabbit Polyclonal Antibody (Fluoro488)
orb3117655 100 µg

SCD Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
ATM Recombinant Antibody, PE-Cy5 Conjugated
bsm-63055R-PE-Cy5 100 µL

ATM Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
SLITRK6 (NM_032229) Human Tagged ORF Clone
RG223564 10 µg

SLITRK6 (NM_032229) Human Tagged ORF Clone

Sign In for Pricing
View Details
Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate
AL1025S-01 500 mL

Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate

Sign In for Pricing
View Details
Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate
AL1025S-02 2x 500 mL

Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate

Sign In for Pricing
View Details