Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THYN1 Rabbit Polyclonal Antibody (Biotin)

THYN1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MY105, THY28, MDS012, HSPC144, THY28KD

UniProt

Q9P016

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human THYN1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD11c Rabbit Monoclonal Antibody (TBS10264) - 20 µg
TBS10264-20 20 µg

Anti-Human CD11c Rabbit Monoclonal Antibody (TBS10264) - 20 µg

Sign In for Pricing
View Details
Lentiviral mouse Akna shRNA (UAS) - Lentiviral mouse Akna shRNA (UAS, iRFP) (100)
GTR15269307 1 Vial

Lentiviral mouse Akna shRNA (UAS) - Lentiviral mouse Akna shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Ralstonia pickettii Adenylate kinase (adk)
MBS1128434-01 0.02 mg (E-Coli)

Recombinant Ralstonia pickettii Adenylate kinase (adk)

Sign In for Pricing
View Details
Recombinant Ralstonia pickettii Adenylate kinase (adk)
MBS1128434-02 0.1 mg (E-Coli)

Recombinant Ralstonia pickettii Adenylate kinase (adk)

Sign In for Pricing
View Details
Recombinant Ralstonia pickettii Adenylate kinase (adk)
MBS1128434-03 0.02 mg (Yeast)

Recombinant Ralstonia pickettii Adenylate kinase (adk)

Sign In for Pricing
View Details
Recombinant Ralstonia pickettii Adenylate kinase (adk)
MBS1128434-04 0.1 mg (Yeast)

Recombinant Ralstonia pickettii Adenylate kinase (adk)

Sign In for Pricing
View Details