Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lgalsl Rabbit Polyclonal Antibody (HRP)

Lgalsl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Grpa, Hspc159, Lgalsla, A530071M23, 1110067D22Rik

UniProt

Q8VED9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_776113

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Beta-hexosaminidase subunit alpha (HEXA) ELISA kit
CSB-EL010315RA-01 24 Well

Rat Beta-hexosaminidase subunit alpha (HEXA) ELISA kit

Sign In for Pricing
View Details
Rat Beta-hexosaminidase subunit alpha (HEXA) ELISA kit
CSB-EL010315RA-02 96 Well

Rat Beta-hexosaminidase subunit alpha (HEXA) ELISA kit

Sign In for Pricing
View Details
Rat Beta-hexosaminidase subunit alpha (HEXA) ELISA kit
CSB-EL010315RA-03 5x 96 Well

Rat Beta-hexosaminidase subunit alpha (HEXA) ELISA kit

Sign In for Pricing
View Details
Rat Beta-hexosaminidase subunit alpha (HEXA) ELISA kit
CSB-EL010315RA-04 10x 96 Well

Rat Beta-hexosaminidase subunit alpha (HEXA) ELISA kit

Sign In for Pricing
View Details
RGD1304731 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV646853 1.0 µg DNA

RGD1304731 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Anti-p53R2 Antibody, Rabbit Monoclonal
MBS8106778-01 0.1 mL

Recombinant Anti-p53R2 Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details