Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOMO1 Rabbit Polyclonal Antibody (Biotin)

NOMO1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PM5, Nomo

UniProt

P69849

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NOMO1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

134kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055102

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIRC59 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV740682 1.0 µg DNA

PIRC59 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Potassium/sodium hyperpolarization-activated Cyclic nucleotide-gated channel 3 (HCN3) Rat ELISA Kit
G0362 96 Tests

Potassium/sodium hyperpolarization-activated Cyclic nucleotide-gated channel 3 (HCN3) Rat ELISA Kit

Sign In for Pricing
View Details
Human Hydroxyacylglutathione hydrolase-like protein, HAGHL ELISA Kit
MBS9317060-01 48 Well

Human Hydroxyacylglutathione hydrolase-like protein, HAGHL ELISA Kit

Sign In for Pricing
View Details
Human Hydroxyacylglutathione hydrolase-like protein, HAGHL ELISA Kit
MBS9317060-02 96 Well

Human Hydroxyacylglutathione hydrolase-like protein, HAGHL ELISA Kit

Sign In for Pricing
View Details
Human Hydroxyacylglutathione hydrolase-like protein, HAGHL ELISA Kit
MBS9317060-03 5x 96 Well

Human Hydroxyacylglutathione hydrolase-like protein, HAGHL ELISA Kit

Sign In for Pricing
View Details
Human Hydroxyacylglutathione hydrolase-like protein, HAGHL ELISA Kit
MBS9317060-04 10x 96 Well

Human Hydroxyacylglutathione hydrolase-like protein, HAGHL ELISA Kit

Sign In for Pricing
View Details