Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOMO1 Rabbit Polyclonal Antibody (FITC)

NOMO1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PM5, Nomo

UniProt

P69849

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NOMO1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

134kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055102

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL12/SDF-1, Tag Free
HA210900-01 20 µg

Human CXCL12/SDF-1, Tag Free

Sign In for Pricing
View Details
Human CXCL12/SDF-1, Tag Free
HA210900-02 50 µg

Human CXCL12/SDF-1, Tag Free

Sign In for Pricing
View Details
Human CXCL12/SDF-1, Tag Free
HA210900-03 100 µg

Human CXCL12/SDF-1, Tag Free

Sign In for Pricing
View Details
Human Tissue Inhibitors Of Metalloproteinase 4 (TIMP4) ELISA Kit
RD-TIMP4-Hu-01 96 Tests

Human Tissue Inhibitors Of Metalloproteinase 4 (TIMP4) ELISA Kit

Sign In for Pricing
View Details
Human Tissue Inhibitors Of Metalloproteinase 4 (TIMP4) ELISA Kit
RD-TIMP4-Hu-02 48 Tests

Human Tissue Inhibitors Of Metalloproteinase 4 (TIMP4) ELISA Kit

Sign In for Pricing
View Details
Prostatic Acid Phosphatase (ACPP) (C-term) Rabbit Polyclonal Antibody
AP14250PU-N 400 µL

Prostatic Acid Phosphatase (ACPP) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details