Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tdrd7 Rabbit Polyclonal Antibody (Biotin)

Tdrd7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pctaire2bp

UniProt

Q9R1R4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

122kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_620226

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD244, Recombinant, Human, aa22-229, Fc-Tag, Avi-Tag
544214 100 µg

CD244, Recombinant, Human, aa22-229, Fc-Tag, Avi-Tag

Sign In for Pricing
View Details
CKMT1A, NT (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) (AP)
MBS6470501-01 0.2 mL

CKMT1A, NT (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) (AP)

Sign In for Pricing
View Details
CKMT1A, NT (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) (AP)
MBS6470501-02 5x 0.2 mL

CKMT1A, NT (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) (AP)

Sign In for Pricing
View Details
Recombinant Human LAMTOR5
MBS7614648-01 0.05 mg

Recombinant Human LAMTOR5

Sign In for Pricing
View Details
Recombinant Human LAMTOR5
MBS7614648-02 0.2 mg

Recombinant Human LAMTOR5

Sign In for Pricing
View Details
Recombinant Human LAMTOR5
MBS7614648-03 1 mg

Recombinant Human LAMTOR5

Sign In for Pricing
View Details