Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hebp2 Rabbit Polyclonal Antibody (HRP)

Hebp2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

D3ZHC4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of RAT Hebp2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EMPSWKAPENIDPQPGSYEIRHYGPAKWVSTCVESLDWDSAIQTGFTKLN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001100985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CFAP210 Protein
E30P70518A 50 µg

Recombinant Human CFAP210 Protein

Sign In for Pricing
View Details
DMC1 (Meiotic Recombination Protein DMC1/LIM15 Homolog, DMC1H, LIM15) (APC)
125905-APC 100 µL

DMC1 (Meiotic Recombination Protein DMC1/LIM15 Homolog, DMC1H, LIM15) (APC)

Sign In for Pricing
View Details
Zc3h12c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
50739116 3x 1.0 µg

Zc3h12c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Polyclonal PDP2 antibody - middle region
APR09019G 0.05mg

Polyclonal PDP2 antibody - middle region

Sign In for Pricing
View Details
C5orf49 Antibody Blocking Peptide
orb1511814 500 µg

C5orf49 Antibody Blocking Peptide

Sign In for Pricing
View Details
AMD Hepatitis G Virus (HGV) PCR Detection Kit
KD347189-100 100 Reactions

AMD Hepatitis G Virus (HGV) PCR Detection Kit

Sign In for Pricing
View Details